PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005791P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NAC
Protein Properties Length: 394aa    MW: 45180.2 Da    PI: 6.585
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005791P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1661.3e-51161441128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  MELO3C005791P1  16 VPPGFRFHPTEEELLHYYLRKKVAFQKIDL-DVIRDVDLNKLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKII 109
                     69****************************.9***************964444222455************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +++ +gl+ktLvfykgrap+g+k+dW+mheyrl
  MELO3C005791P1 110 YT-GSKRIGLRKTLVFYKGRAPHGQKSDWIMHEYRL 144
                     *9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-5710175IPR003441NAC domain
PROSITE profilePS5100556.90216175IPR003441NAC domain
PfamPF023655.0E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MAEQDMTLSV NGHSQVPPGF RFHPTEEELL HYYLRKKVAF QKIDLDVIRD VDLNKLEPWD  60
IQEKCKIGST PQNDWYFFSH KDKKYPTGTR TNRATAAGFW KATGRDKIIY TGSKRIGLRK  120
TLVFYKGRAP HGQKSDWIMH EYRLDDSDRD INICNSIGES QLAEDGWVVC RVFKKKNYQK  180
SIDSPKTSPT SMDSEVHLLN SNNDGVLDQI LQYMGRTCKL EMESFSNNIN NNNNSSSRLI  240
LSPNNNTEDH QQQTIDKSFM HLPRLDSPTT IPSIISLHQL ETSSPFDHNI IFNHEMLSVS  300
ETTTEPSPRP VVKLDNWVAF DRLVASQLNG HDERSAIEDD EDEQQQHHHQ QQQHHHHMQV  360
SNRGLGYGHE NDIWGFTKSS SSSSLDPLSH LSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-5031776170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008437451.10.0PREDICTED: NAC domain-containing protein 12
SwissprotQ9LPI71e-119NAC12_ARATH; NAC domain-containing protein 12
TrEMBLA0A0A0KQL00.0A0A0A0KQL0_CUCSA; Uncharacterized protein
STRINGVIT_02s0025g02710.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-105NAC family protein